Science Explorer Back to mapMap
Discussion
Hospital / health system · Salisbury · United Kingdom

Salisbury District Hospital

In research, Salisbury District Hospital stands highest in Health Sciences (#6,547 of 16,688 worldwide), Medicine (#5,844 of 14,558 worldwide) and Surgery (#2,094 of 3,248 worldwide), over all time.

salisbury.nhs.uk/aboutus/media/pages/salisburydistricthospitalteamswinpatientsafetyawards.aspxROR OpenAlex
World rank, 2022-now
#21,464
of 22,385 · #14,207 all time
Rank in United Kingdom
#809
of 862
Research works
1.2k
▼ 12% vs 2018-21
Citations
41k
34.3 per fractional work
Top-10% rate
4.2%
all institutions 10.0%
vs its own fields
0.94×
1.00× is exactly expected
Open access
31%
world 40%
International
18%
world 18%
Salisbury District Hospital

What is Salisbury District Hospital known for in research?

The fields where it stands highest, over all time, ranked among every institution above the floor in each field.

FieldWorld rankWhere that sitsTop-10% rateWorks
Health SciencesDomain #6,547 of 16,688 8.6%784
MedicineField #5,844 of 14,558 8.6%703
SurgerySubfield #2,094 of 3,248 7.2%161
Life SciencesDomain #7,454 of 11,023 11.8%276
Biochemistry, Genetics and Molecular BiologyField #4,255 of 5,801 10.8%175

Each strip is that field's whole ranked pool, with the notch where Salisbury District Hospital sits in it, in the colour of the band that rank falls in. The track under the rate is the rate itself: it carries no average mark, because the average differs by field (from about 6% in Dentistry to 21% in Economics).

Which fields of science does Salisbury District Hospital work in?

In 2022-now, 75% of research at Salisbury District Hospital is in Health Sciences, 14% in Life Sciences. Its largest fields are Medicine (69%), Biochemistry, Genetics and Molecular Biology (8%), Agricultural and Biological Sciences (4%). It does 2.9× the world's share of Health Sciences.

Health Sciences: 58 fractional works · 74.7% of its workMedicine: 54 fractional works · 69.1% of its workSurgery: 16 fractional works · 20.9% of its workPulmonary and Respiratory Medicine: 4 fractional works · 4.7% of its workEpidemiology: 3 fractional works · 4.4% of its workOncology: 3 fractional works · 3.5% of its workRadiology, Nuclear Medicine and Imaging: 2 fractional works · 2.9% of its workPublic Health, Environmental and Occupational Health: 2 fractional works · 2.8% of its workGenetics: 2 fractional works · 2.4% of its workRheumatology: 2 fractional works · 2.3% of its workEndocrinology, Diabetes and Metabolism: 2 fractional works · 2.2% of its workOphthalmology: 2 fractional works · 2.1% of its workCardiology and Cardiovascular Medicine: 2 fractional works · 2.0% of its workPathology and Forensic Medicine: 1 fractional works · 1.8% of its workPhysiology: 1 fractional works · 1.5% of its workComplementary and alternative medicine: 1 fractional works · 1.3% of its workInfectious Diseases: 1 fractional works · 1.2% of its workRehabilitation: 1 fractional works · 1.1% of its workOtorhinolaryngology: 1 fractional works · 1.1% of its workCritical Care and Intensive Care Medicine: 1 fractional works · 1.0% of its workUrology: 1 fractional works · 0.9% of its workDermatology: 1 fractional works · 0.9% of its workPediatrics, Perinatology and Child Health: 1 fractional works · 0.8% of its workHepatology: 1 fractional works · 0.8% of its workAnesthesiology and Pain Medicine: 1 fractional works · 0.8% of its workHealth Informatics: 1 fractional works · 0.7% of its workBiochemistry: 1 fractional works · 0.7% of its workGeriatrics and Gerontology: 0 fractional works · 0.6% of its workPsychiatry and Mental health: 0 fractional works · 0.6% of its workEmergency Medicine: 0 fractional works · 0.6% of its workHematology: 0 fractional works · 0.5% of its workTransplantation: 0 fractional works · 0.4% of its workObstetrics and Gynecology: 0 fractional works · 0.4% of its workNeurology: 0 fractional works · 0.4% of its workNephrology: 0 fractional works · 0.3% of its workImmunology and Allergy: 0 fractional works · 0.2% of its workSmaller subfields together: 0 fractional works · 0.4% of its workDentistry: 2 fractional works · 3.0% of its workOral Surgery: 2 fractional works · 2.2% of its workOrthodontics: 0 fractional works · 0.5% of its workSmaller subfields together: 0 fractional works · 0.3% of its workHealth Professions: 2 fractional works · 2.2% of its workGeneral Health Professions: 1 fractional works · 1.3% of its workOccupational Therapy: 0 fractional works · 0.4% of its workEmergency Medical Services: 0 fractional works · 0.2% of its workSpeech and Hearing: 0 fractional works · 0.2% of its workSmaller subfields together: 0 fractional works · 0.1% of its workVeterinary: 0 fractional works · 0.3% of its workNursing: 0 fractional works · 0.2% of its workLife Sciences: 11 fractional works · 14.1% of its workBiochemistry, Genetics and Molecular Biology: 6 fractional works · 7.5% of its workGenetics: 3 fractional works · 3.3% of its workMolecular Biology: 2 fractional works · 2.8% of its workCell Biology: 0 fractional works · 0.4% of its workCancer Research: 0 fractional works · 0.3% of its workBiochemistry: 0 fractional works · 0.2% of its workSmaller subfields together: 0 fractional works · 0.4% of its workAgricultural and Biological Sciences: 3 fractional works · 3.7% of its workPlant Science: 1 fractional works · 1.3% of its workEcology, Evolution, Behavior and Systematics: 1 fractional works · 1.2% of its workInsect Science: 1 fractional works · 0.8% of its workFood Science: 0 fractional works · 0.4% of its workNeuroscience: 2 fractional works · 2.2% of its workCognitive Neuroscience: 1 fractional works · 1.5% of its workCellular and Molecular Neuroscience: 0 fractional works · 0.2% of its workSensory Systems: 0 fractional works · 0.2% of its workNeurology: 0 fractional works · 0.2% of its workImmunology and Microbiology: 1 fractional works · 0.7% of its workImmunology: 0 fractional works · 0.4% of its workParasitology: 0 fractional works · 0.3% of its workPhysical Sciences: 4 fractional works · 5.8% of its workEngineering: 2 fractional works · 2.5% of its workBiomedical Engineering: 2 fractional works · 2.4% of its workSmaller subfields together: 0 fractional works · 0.1% of its workEnvironmental Science: 1 fractional works · 1.0% of its workManagement, Monitoring, Policy and Law: 0 fractional works · 0.6% of its workSmaller subfields together: 0 fractional works · 0.4% of its workEarth and Planetary Sciences: 1 fractional works · 0.9% of its workPaleontology: 0 fractional works · 0.4% of its workAtmospheric Science: 0 fractional works · 0.2% of its workSmaller subfields together: 0 fractional works · 0.3% of its workChemistry: 0 fractional works · 0.4% of its workOrganic Chemistry: 0 fractional works · 0.4% of its workMathematics: 0 fractional works · 0.4% of its workStatistics and Probability: 0 fractional works · 0.4% of its workComputer Science: 0 fractional works · 0.2% of its workArtificial Intelligence: 0 fractional works · 0.2% of its workMaterials Science: 0 fractional works · 0.2% of its workPolymers and Plastics: 0 fractional works · 0.2% of its workSocial Sciences: 4 fractional works · 5.4% of its workSocial Sciences: 2 fractional works · 2.9% of its workSociology and Political Science: 1 fractional works · 0.7% of its workHealth: 0 fractional works · 0.5% of its workPolitical Science and International Relations: 0 fractional works · 0.4% of its workAnthropology: 0 fractional works · 0.2% of its workDemography: 0 fractional works · 0.2% of its workEducation: 0 fractional works · 0.2% of its workGeography, Planning and Development: 0 fractional works · 0.2% of its workUrban Studies: 0 fractional works · 0.2% of its workSmaller subfields together: 0 fractional works · 0.2% of its workPsychology: 1 fractional works · 1.1% of its workSocial Psychology: 0 fractional works · 0.6% of its workClinical Psychology: 0 fractional works · 0.3% of its workExperimental and Cognitive Psychology: 0 fractional works · 0.2% of its workArts and Humanities: 1 fractional works · 0.7% of its workArcheology: 0 fractional works · 0.6% of its workSmaller subfields together: 0 fractional works · 0.1% of its workBusiness, Management and Accounting: 0 fractional works · 0.5% of its workManagement Information Systems: 0 fractional works · 0.2% of its workStrategy and Management: 0 fractional works · 0.2% of its workSmaller subfields together: 0 fractional works · 0.1% of its workDecision Sciences: 0 fractional works · 0.1% of its workEconomics, Econometrics and Finance: 0 fractional works · 0.1% of its workALL ITS WORKSalisburyDistrict Hospital78fractional works, 2022-now
Life Sciences14%Physical Sciences6%Health Sciences75%Social Sciences5%

Each ring splits the one inside it: the four domains of science, their fields, their subfields. Size is fractional works in 2022-now. Every slice is a page; the interactive view zooms down to single topics and colours each by how much more of it this institution does than the world.

Its 4 domains and 22 fields, with their numbers
    1. Medicine5469.1%
    2. Dentistry23.0%
    3. Health Professions22.2%
    4. Veterinary00.3%
    5. Nursing00.2%
    1. Biochemistry, Genetics and Molecular Biology67.5%
    2. Agricultural and Biological Sciences33.7%
    3. Neuroscience22.2%
    4. Immunology and Microbiology10.7%
    1. Engineering22.5%
    2. Environmental Science11.0%
    3. Earth and Planetary Sciences10.9%
    4. Chemistry00.4%
    5. Mathematics00.4%
    6. Computer Science00.2%
    7. Materials Science00.2%
    1. Social Sciences22.9%
    2. Psychology11.1%
    3. Arts and Humanities10.7%
    4. Business, Management and Accounting00.5%
    5. Decision Sciences00.1%
    6. Economics, Econometrics and Finance00.1%
All of science, and how each field's share has moved since 1950: the Science domain explorer

Field profile

Location quotient across every field it publishes in: outside the ring is more than an institution of this size would be expected to publish, inside it is less.

Agricultural and Biological Sciences: 0.78× its world share, 3 worksAgricultural and Bio…Biochemistry, Genetics and Molecular Biology: 1.41× its world share, 6 worksBiochemistry, Geneti…Immunology and Microbiology: 0.71× its world share, 1 worksImmunology and Micro…Neuroscience: 1.35× its world share, 2 worksNeuroscienceChemistry: 0.27× its world share, 0 worksChemistryComputer Science: 0.03× its world share, 0 worksComputer ScienceEarth and Planetary Sciences: 0.60× its world share, 1 worksEarth and Planetary …Engineering: 0.17× its world share, 2 worksEngineeringEnvironmental Science: 0.20× its world share, 1 worksEnvironmental ScienceMaterials Science: 0.06× its world share, 0 worksMaterials ScienceMathematics: 0.36× its world share, 0 worksMathematicsDentistry: 6.16× its world share, 2 worksDentistryHealth Professions: 0.84× its world share, 2 worksHealth ProfessionsMedicine: 3.59× its world share, 54 worksMedicineNursing: 0.33× its world share, 0 worksNursingVeterinary: 2.21× its world share, 0 worksVeterinaryArts and Humanities: 0.25× its world share, 1 worksArts and HumanitiesBusiness, Management and Accounting: 0.16× its world share, 0 worksBusiness, Management…Decision Sciences: 0.09× its world share, 0 worksDecision SciencesEconomics, Econometrics and Finance: 0.03× its world share, 0 worksEconomics, Econometr…Psychology: 0.36× its world share, 1 worksPsychologySocial Sciences: 0.23× its world share, 2 worksSocial Sciences1×world share
more than its size predictsabout as predictedless

Rings at 0.5×, 1× and 2×. Widest outward: Dentistry, 6.2×. Every wedge is a field page.

All 22 fields, with their numbers
  1. Dentistry6.16×2 works
  2. Medicine3.59×54 works
  3. Veterinary2.21×0 works
  4. Biochemistry, Genetics and Molecular Biology1.41×6 works
  5. Neuroscience1.35×2 works
  6. Health Professions0.84×2 works
  7. Agricultural and Biological Sciences0.78×3 works
  8. Immunology and Microbiology0.71×1 works
  9. Earth and Planetary Sciences0.60×1 works
  10. Mathematics0.36×0 works
  11. Psychology0.36×1 works
  12. Nursing0.33×0 works
  13. Chemistry0.27×0 works
  14. Arts and Humanities0.25×1 works
  15. Social Sciences0.23×2 works
  16. Environmental Science0.20×1 works
  17. Engineering0.17×2 works
  18. Business, Management and Accounting0.16×0 works
  19. Decision Sciences0.09×0 works
  20. Materials Science0.06×0 works
  21. Computer Science0.03×0 works
  22. Economics, Econometrics and Finance0.03×0 works

Who are the top researchers at Salisbury District Hospital?

Ranked on the quality score, Graham Branagan, P. A. Jacobs and David A. J. Tyrrell lead among researchers whose main affiliation is Salisbury District Hospital.

  1. 1 Graham Branagan United Kingdom · #164,389 worldwide 3.8k citations · 100 works
  2. 2 P. A. Jacobs United Kingdom · #841,343 worldwide 10k citations · 149 works
  3. 3 David A. J. Tyrrell United Kingdom · #1,262,085 worldwide 18k citations · 442 works
  4. 4 M. Seabright United Kingdom · #1,593,997 worldwide 6.7k citations · 41 works
  5. 5 Rebecca J Gardner United Kingdom · #1,988,880 worldwide 1.7k citations · 25 works
  6. 6 Ginette Phippen United Kingdom · #2,248,246 worldwide 306 citations · 15 works
  7. 7 S. E. Reed United Kingdom · #2,544,725 worldwide 1k citations · 22 works
  8. 8 Nigel T. North United Kingdom · #2,574,049 worldwide 1.4k citations · 45 works
  9. 9 A. S. Beare United Kingdom · #2,622,272 worldwide 3k citations · 61 works
  10. 10 Tim Wells United Kingdom · #2,945,367 worldwide 345 citations · 28 works
All ranked researchers at Salisbury District Hospital

What are the most cited papers from Salisbury District Hospital?

The most cited paper from Salisbury District Hospital is "A RAPID BANDING TECHNIQUE FOR HUMAN CHROMOSOMES" (M. Seabright, 1971), with 5,047 citations. Next come "High-Throughput Droplet Digital PCR System for Absolute Quantitation of DNA Copy Number" (2,861) and "STROCSS 2021: Strengthening the reporting of cohort, cross-sectional and case-control studies in surgery" (2,166).

Most cited papers
#PaperReleasedCitations
1 A RAPID BANDING TECHNIQUE FOR HUMAN CHROMOSOMES M. Seabright · The Lancet Oct 1971 5,047
2 High-Throughput Droplet Digital PCR System for Absolute Quantitation of DNA Copy Number Benjamin J. Hindson et al. · Analytical Chemistry Open access 28 Oct 2011 2,861
3 STROCSS 2021: Strengthening the reporting of cohort, cross-sectional and case-control studies in surgery Ginimol Mathew et al. · International Journal of Surgery Open access 10 Nov 2021 2,166
4 Activating Mutations in the Gene Encoding the ATP-Sensitive Potassium-Channel Subunit Kir6.2 and Permanent Neonatal Diabetes Anna L. Gloyn et al. · New England Journal of Medicine 28 Apr 2004 1,151
5 Mapping the human genetic architecture of COVID-19 COVID-19 Host Genetics Initiative et al. · Nature Open access3,896 authors 8 Jul 2021 1,130
All 59 most cited papers, with filters and sorting

Which keywords describe research at Salisbury District Hospital?

By fractional works in 2022-now, weighted toward what it does more of than the world: Epidemiology, Complications, Revision Surgery, Total Hip Replacement, Biomechanics, Patient Satisfaction, Health-related Quality of Life and Inflammation.

▲ more of its work than of the world's◆ about the world's share▼ less than the world's

Size is fractional works in 2022-now in the topics tagged with each word; colour is the word's share of this institution's work against its share of the world's. The 40 words are chosen for being large and distinctive. Each links to the topic it comes from most.

All 40 words, with their numbers
  1. Epidemiology11▲ 3.4×36 topics
  2. Complications6▲ 15×12 topics
  3. Inflammation4▲ 2.2×17 topics
  4. Immunotherapy2▲ 4.4×8 topics
  5. Biomechanics2▲ 10×5 topics
  6. Revision Surgery2▲ 25×2 topics
  7. Total Hip Replacement2▲ 25×2 topics
  8. Patient Satisfaction2▲ 9.6×4 topics
  9. Diagnosis2▲ 2.8×9 topics
  10. Health-related Quality of Life2▲ 11×2 topics
  11. Management2▲ 3.2×6 topics
  12. Melanoma2▲ 40×2 topics
  13. Arthroplasty2▲ 24×1 topic
  14. Infection Prevention2▲ 25×3 topics
  15. Mortality2▲ 4.1×8 topics
  16. Surgical Management2▲ 5.5×8 topics
  17. Survival Analysis2▲ 8.3×3 topics
  18. Total Knee Replacement2▲ 35×1 topic
  19. Breast Reconstruction2▲ 36×2 topics
  20. Skin Cancer2▲ 29×2 topics
  21. Dermoscopy2▲ 46×1 topic
  22. Sentinel Lymph Node Biopsy2▲ 24×1 topic
  23. Tumor Staging2▲ 19×2 topics
  24. Adverse Reactions2▲ 33×2 topics
  25. Free Flap2▲ 47×1 topic
  26. Guidelines2▲ 4.2×7 topics
  27. Microsurgical Reconstruction2▲ 47×1 topic
  28. Radiotherapy2▲ 5.0×7 topics
  29. Distal Radius Fractures1▲ 35×1 topic
  30. Flexor Tendon Repair1▲ 35×1 topic
  31. Anatomy1▲ 22×2 topics
  32. Anterior Cruciate Ligament1▲ 41×1 topic
  33. Injury Risk1▲ 41×1 topic
  34. Internal Fixation1▲ 25×2 topics
  35. Atherosclerosis1▲ 5.5×6 topics
  36. Bone Healing1▲ 35×1 topic
  37. Fracture Epidemiology1▲ 35×1 topic
  38. Hemorrhage1▲ 20×3 topics
  39. Regeneration1▲ 7.2×4 topics
  40. Cardiac Imaging1▲ 11×2 topics

Which research topics does Salisbury District Hospital publish most on?

By volume in 2022-now: Total Knee Arthroplasty Outcomes, Cutaneous Melanoma Detection and Management, Reconstructive Surgery and Microvascular Techniques and Orthopedic Surgery and Rehabilitation.

Total Knee Arthroplasty …2Total Knee Arthroplasty Outcomes: 2 fractional worksCutaneous Melanoma Detec…2Cutaneous Melanoma Detection and Management: 2 fractional worksReconstructive Surgery a…2Reconstructive Surgery and Microvascular Techniques: 2 fractional worksOrthopedic Surgery and R…1Orthopedic Surgery and Rehabilitation: 1 fractional worksKnee injuries and reconstruction techniques: 1 fractional worksBone fractures and treatments: 1 fractional worksComplementary and Altern…1Complementary and Alternative Medicine Studies: 1 fractional worksTracheal and airway disorders: 1 fractional worksReconstructive Facial Surgery Techniques: 1 fractional worksCardiac Imaging and Diagnostics: 1 fractional works
SurgeryOncologyEpidemiologyComplementary and alternative medicine2 others

Area is fractional works; colour is the subfield each topic belongs to.

  1. 1 Total Knee Arthroplasty Outcomes Surgery 2 works
  2. 2 Cutaneous Melanoma Detection and Management Oncology 2 works
  3. 3 Reconstructive Surgery and Microvascular Techniques Surgery 2 works
  4. 4 Orthopedic Surgery and Rehabilitation Surgery 1 works
  5. 5 Knee injuries and reconstruction techniques Surgery 1 works
  6. 6 Bone fractures and treatments Epidemiology 1 works
  7. 7 Complementary and Alternative Medicine Studies Complementary and alternative medicine 1 works
  8. 8 Tracheal and airway disorders Pulmonary and Respiratory Medicine 1 works
  9. 9 Reconstructive Facial Surgery Techniques Surgery 1 works
  10. 10 Cardiac Imaging and Diagnostics Radiology, Nuclear Medicine and Imaging 1 works

How open and international is its research?

Against the world's own shares: the tick on each track. Both are shares of its output, so they sit on one scale and can be read against each other as well as against the world.

openly available30.9%not open69.1%

World: 40% of research is openly available.

with international co-authors18.3%domestic only81.7%

World: 18% is written across borders.

How has Salisbury District Hospital's research output changed?

Output in 2022-2025 was 12% lower than in 2018-2021.

still counting1990200020102020
grewheldshrank

The same series as a ribbon: one cell per year, darker for more. The line above answers how much; this answers when.

Its share of all research

Growing output can still be a shrinking share: all of science grows. This is Salisbury District Hospital as a percentage of every work published that year, 0.00038% in 2024.

still counting0.0020%0.0040%0.0060%Salisbury District Hospital0.00027% in 202519801990200020102020

Fractional works of Salisbury District Hospital over all fractional works that year. How the balance of science has shifted.

How much of it reaches the world top 10%

Year by year, against all institutions in the same year.

10%20%all institutions10.0% in 2024Salisbury District Hospital4.0% in 2024200020102020

Of each year's output, the share that reached the world's 10% most cited for its field and year. Peak 17.9% in 2005.

Other research institutions in Salisbury

All research institutions in Salisbury

Share Salisbury District Hospital's ranking

Salisbury District Hospital on Science Explorer

A card with Salisbury District Hospital's standing and the fields it leads in, for a post or a slide. A link to this page previews as the same card.

Download the card

1200 × 630 PNG, sized for social posts, drawn from the latest snapshot.

Badges for a website1Each links back here and updates with every snapshot

Research measures only: rankings here say nothing about teaching, admissions or student experience. Comparable institutions and collaboration partners have tabs of their own, above.

Discussion

Ask a question or share a note about Salisbury District Hospital. Keep it to the research: no personal attacks, advertising or links. Any reader can report a post, which collapses it for everyone until it is opened.